General Information

  • ID:  hor006976
  • Uniprot ID:  P21781
  • Protein name:  Fibroblast growth factor 7
  • Gene name:  TTR
  • Organism:  Homo sapiens
  • Family:  Heparin-binding growth factors family
  • Source:  Animal
  • Expression:  Epithelial cell.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005737 cytoplasm; GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005794 Golgi apparatus
  • GO BP:  GO:0042056 chemoattractant activity; GO:0008083 growth factor activity; GO:0008201 heparin binding; GO:0005111 type 2 fibroblast growth factor receptor binding
  • GO CC:  GO:0008543 fibroblast growth factor receptor signaling pathway; GO:0034394 protein localization to cell surface; GO:0060665 regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling; GO:0030334 regulation of cell migration; GO:0031069 hair follicle morphogenesis; GO:0009611 response to wounding; GO:0010463 mesenchymal cell proliferation; GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation; GO:0061033 secretion by lung epithelial cell involved in lung growth; GO:0007165 signal transduction; GO:0050918 positive chemotaxis; GO:0030036 actin cytoskeleton organization; GO:0030324 lung development; GO:2000288 positive regulation of myoblast proliferation; GO:0051450 myoblast proliferation; GO:0010838 positive regulation of keratinocyte proliferation; GO:0008284 positive regulation of cell population proliferation; GO:0051781 positive regulation of cell division; GO:0043410 positive regulation of MAPK cascade; GO:0009887 animal organ

Sequence Information

  • Sequence:  NDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
  • Length:  162
  • Propeptide:  MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
  • Signal peptide:  MHKWILTWILPTLLYRSCFHIICLVGTISLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA